Protein Info for Rru_A1234 in Rhodospirillum rubrum S1H

Annotation: Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
  • amino acids 13 to 512 (500 residues), 653.8 bits, E=7.9e-201
• PF01676: Metalloenzyme
  • amino acids 13 to 501 (489 residues), 267.7 bits, E=1.1e-83
• PF06415: iPGM_N
  • amino acids 90 to 298 (209 residues), 231.8 bits, E=7e-73

Best Hits

Swiss-Prot: 61% identical to GPMI_RHOPA: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to rru:Rru_A1234)

MetaCyc: 48% identical to 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Haloferax volcanii)
3PGAREARR-RXN [EC: 5.4.2.12]

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• Rubisco shunt (10/10 steps found)
• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• glycerol degradation to butanol (12/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• photorespiration II (6/10 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.12

Sequence Analysis Tools

See Q2RV10 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Rru_A1234 Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent (NCBI) (Rhodospirillum rubrum S1H)
MTSQMPPFRRPRPVVLCILDGWGHRDDPTDNAIALANTPTWDRLMATCPHSLIATSGADV
GLPAGQMGNSEVGHMNIGAGRVVMQDLPRIDAALADGSVAHFPALVRFIDALRASGGTAH
LLGLLSPGGVHSHQDHIAKLARVIAAAGVPVKIHAFLDGRDTPPRSALGFLETFAAAAGP
EAPIATVSGRYYAMDRDKRFDRVRLAYDVLVSGKGESAADAASAVSQFYDSKDKGDEFVL
PTAIAGYDGMKDGDGVFMVNYRSDRAREITQALLDPTFDGFERQPPHFAGALAMTEYSTA
HNAFMDVLFGPESLNNILGQVVSEAGMTQLRIAETEKYAHVTFFFNGGRETSFPGEERIL
IPSPKVATYDLQPEMSAPELTDRLVEVIDAGRFDVIIVNYANGDMVGHSGILEAAIKAVE
AVDGCLGRVEEAVVRAGGTMLVTADHGNAELMRDPVTGEPHTAHTTGRVDLLLVNGPEGA
SLADGRLADLSPTLLALIGLPQPAEMTGKTLVAKAAVAVGASH