Protein Info for Rru_A1226 in Rhodospirillum rubrum S1H

Annotation: ATP synthase F1, beta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR01039: ATP synthase F1, beta subunit" amino acids 6 to 469 (464 residues), 837.9 bits, see alignment E=1e-256 PF02874: ATP-synt_ab_N" amino acids 9 to 75 (67 residues), 67.7 bits, see alignment E=1.6e-22 PF00006: ATP-synt_ab" amino acids 132 to 351 (220 residues), 228.9 bits, see alignment E=8.1e-72 PF22919: ATP-synt_VA_C" amino acids 359 to 443 (85 residues), 59.9 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 100% identical to ATPB_RHORT: ATP synthase subunit beta (atpD) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 100% identity to rru:Rru_A1226)

MetaCyc: 78% identical to ATP synthase subunit beta, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV18 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Rru_A1226 ATP synthase F1, beta subunit (NCBI) (Rhodospirillum rubrum S1H)
MAKNNLGTITQVTGAVVDVKFEGELPSILSALETDNHGNRLVLEVAQHLGESVVRTIAMD
STEGLVRGQQVTSTGGPITVPVGPQVLGRIMNVIGEPVDERGPVVTAQRYPIHRQAPTFA
EQATETEILVTGIKVIDLIAPYTKGGKVGLFGGAGVGKTVLIQELINNVAKGHGGYSVFA
GVGERTREGNDLYHEMIDAGIIDLEGDKSKVALVYGQMNEPPGARARVALAGLTQAEYFR
DEEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGALQERITSTKKGSI
TSVQAIYVPADDLTDPAPAASFAHLDATTTLNRSIAELGIYPAVDPLDSTSRALDPLVVG
EEHYKVAREVQRVLQTYKSLQDIIAILGMDELSEEDRLVVARARKIQRFLSQPFHVAEVF
TGSPGKLVSLEDTIKGFKGLVEGEYDHLPEQAFYMVGNMAEAIEKAKKMAAEAA