Protein Info for Rru_A1224 in Rhodospirillum rubrum S1H

Annotation: ATP synthase F1, alpha subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 TIGR00962: ATP synthase F1, alpha subunit" amino acids 3 to 510 (508 residues), 824.2 bits, see alignment E=2e-252 PF02874: ATP-synt_ab_N" amino acids 25 to 91 (67 residues), 74 bits, see alignment E=1.7e-24 PF00006: ATP-synt_ab" amino acids 149 to 373 (225 residues), 270.6 bits, see alignment E=1.5e-84 PF00306: ATP-synt_ab_C" amino acids 380 to 505 (126 residues), 161.7 bits, see alignment E=1.6e-51

Best Hits

Swiss-Prot: 100% identical to ATPA_RHORU: ATP synthase subunit alpha (atpA) from Rhodospirillum rubrum

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 100% identity to rru:Rru_A1224)

MetaCyc: 70% identical to ATP synthase subunit alpha, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV20 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Rru_A1224 ATP synthase F1, alpha subunit (NCBI) (Rhodospirillum rubrum S1H)
MEIRAAEISAILKEQIANFGTEAESAEVGQVLSVGDGIARVYGLDNVQAGEMVEFANGVK
GMALNLESDNVGIVIFGEDRGIKEGDVVKRTQTIVDVPVGKGLLGRVVDGLGNPIDGKGD
LVDVERKRAEVKAPGIIPRKSVHEPVQTGIKAIDSLIPIGRGQRELIIGDRQTGKTAVIL
DTILNQKAVNDKAKDDSEKLFCVYVAVGQKRSTVAQVVKVLADHGALDYTIVVAATASEP
APLQFLAPYTGCTMGEFFRDNGMHAVIFYDDLTKQAVAYRQMSLLLRRPPGREAFPGDVF
YLHSRLLERAAKLNDDNGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFK
GIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKLELAQYREMAAFAQFASDLDPATQKLLA
RGARLTELLKQAQYSPLAVEEQVCVIYAGTRGYLDKLKTTDVVRYEASLLGALRTSGADL
LESIRTGKALSKEIEQKLVKFLDDFGKKFA