Protein Info for Rru_A1222 in Rhodospirillum rubrum S1H

Annotation: Primosomal protein n (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 811 PF17764: PriA_3primeBD" amino acids 27 to 119 (93 residues), 70.1 bits, see alignment E=2.9e-23 PF04851: ResIII" amino acids 229 to 357 (129 residues), 42.7 bits, see alignment E=1.4e-14 PF00270: DEAD" amino acids 248 to 395 (148 residues), 60.7 bits, see alignment E=3.9e-20 TIGR00595: primosomal protein N'" amino acids 250 to 808 (559 residues), 739.9 bits, see alignment E=7.1e-227 PF18319: Zn_ribbon_PriA" amino acids 529 to 555 (27 residues), 42.9 bits, see alignment (E = 9.4e-15) PF18074: PriA_C" amino acids 717 to 807 (91 residues), 65.3 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 100% identical to PRIA_RHORU: Primosomal protein N' (priA) from Rhodospirillum rubrum

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to rru:Rru_A1222)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV22 at UniProt or InterPro

Protein Sequence (811 amino acids)

>Rru_A1222 Primosomal protein n (NCBI) (Rhodospirillum rubrum S1H)
MAGLPALPPGSRELFPEDAHAEPVVAVLLPLPLAGAYDYKVPAGMARPAVGTLVRVPLGR
REEIGVVWGAGAGETPPERLKPLIGFPECPPLPAPLRAFIDWVAAYTVQPPGAVLRMALS
VPAALEAPPPALGWRRPSAGQRAAGQRAEGQGPLPGGARLSPGRQRVLAVLDDHPGLPFA
GADLAREAAVGPAVVAAMAKAGLLEAVTRSNEWSPQAPDADRPGPLLSADQQAAADGLRT
ALDQGFSGLLLEGVTGSGKTEVYFEAIAETLRRGRQALVLLPEIALAAQWPRRFADRFGA
APVQWHSQMGAAARRRAWRAVALGRAPVVVGARSALFLPYPDLGLIIVDEEHDSAFKQEE
GVPYNARDMAVVRARLGGFPAVLASATPSLETIENARQGRYRHLVLPRRHGGAEMPEITL
LDLRRAPPQKWLPTDFAGPGGSEGLAAPGGANDEAEEQKAPPPSPTASPSPTASPSPMAR
PARLGWLSPPLITAVEETLAAGEQVLLFLNRRGYAPLTLCRSCGHRLKCPRCTAWLVEHR
RDGRLRCHHCGYQQPIPETCPACGVADSLAPCGPGVERLAEEAAHRFPKARMDVAASDTV
TGPKEAAALATRIANHDIDLIIGTQIMAKGHHFPLITLVGVVDGDLGLTGGDLRASERTH
QLLHQVAGRAGRAERPGRVLIQTVDPGHPVMEALASGDPALFLEVEAAERQALAMPPFGR
LVALVISGEDSARVQAVAAALGRAAPMGPGLDVLGPVPAPLAMLRGRHRHRLLLKAARGV
KVQPVVRHWLSLVSIPPGVKVQVDVDPISFL