Protein Info for Rru_A1219 in Rhodospirillum rubrum S1H

Annotation: Sigma54 Specific Transcriptional Regulator containing PAS, and Fis DNA-binding domains (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00158: Sigma54_activat" amino acids 7 to 169 (163 residues), 191.4 bits, see alignment E=2e-60 TIGR02974: psp operon transcriptional activator" amino acids 7 to 328 (322 residues), 477.1 bits, see alignment E=1.6e-147 PF14532: Sigma54_activ_2" amino acids 23 to 178 (156 residues), 50.7 bits, see alignment E=4.5e-17 PF07728: AAA_5" amino acids 31 to 148 (118 residues), 32.5 bits, see alignment E=1.6e-11 PF02954: HTH_8" amino acids 291 to 325 (35 residues), 23.3 bits, see alignment 8.3e-09

Best Hits

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 100% identity to rru:Rru_A1219)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV25 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Rru_A1219 Sigma54 Specific Transcriptional Regulator containing PAS, and Fis DNA-binding domains (NCBI) (Rhodospirillum rubrum S1H)
MDTLPPIIGEDPAFLDVIEQASRLAPIDRPCLVVGERGTGKELVAARLHYLSRRWQGPLV
KVNCAALSDTLLESELFGHEAGAFTGAQRRHLGRFERAEGGTLILDEIANASQAVQEKVL
RVIEYGELERVGGAATLRVDVRVIGVANVDLPKRAAEGGFRADLLDRLAFDVLTLPPLRA
RPGDILALAEAFARAMAGDLERPAPAFSPAARAQLLGHGWPGNVRELRNASERTVARLPR
EATVIETVVIDPFASPWCLAAAPAAPPAILSPADGALPPEGQPFAAAVAAYEQGLLRRAL
AAAEGNQGKAAQALGLGYHQFRRLLARHGLGPGAER