Protein Info for Rru_A1214 in Rhodospirillum rubrum S1H

Annotation: Dihydrolipoamide succinyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00364: Biotin_lipoyl" amino acids 4 to 75 (72 residues), 76.9 bits, see alignment E=1.3e-25 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 4 to 430 (427 residues), 553.3 bits, see alignment E=2e-170 PF02817: E3_binding" amino acids 135 to 166 (32 residues), 33.3 bits, see alignment (E = 7e-12) PF00198: 2-oxoacid_dh" amino acids 200 to 429 (230 residues), 284.4 bits, see alignment E=9.9e-89

Best Hits

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to rru:Rru_A1214)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV30 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Rru_A1214 Dihydrolipoamide succinyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MATEIIVPQLGESVSEATVAKWFKKVGDAVAADEPLVELETDKVTVEVPAPAAGTLSEII
AAEGAEVAVGAVLALLAGAGEGAAPAKPAAAPAEKKAEPEKKPEAEKKAGPEKKAEPVAA
AAPKAASAPLDYPLPPAVRKLVDDNALDPARIPATGKDGRLTRDDVVAFLKAGAPAGAPA
SAPAPASAPAAGPAREAGPREEKVKMTRLRRRIAERLKEAQNTAAILTTFNEVDMTNLMA
LRNQYKESFEKKHGVKLGFMSFFVKACVKALQEMPAVNSEISGDSLIYKNYYDIGVAVGG
AQGLVVPVVRDCDAKSFATIEADIAGYGKKARDGSLTMEEMAGGTFTVSNGGVYGSLMST
PIINPPQSAILGMHKTMMRPMVMPDGSIAARPMMYLALSYDHRIVDGKEAVTFLVRVKEC
IEDPARLLLDA