Protein Info for Rru_A1214 in Rhodospirillum rubrum S1H

Annotation: Dihydrolipoamide succinyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 75 (72 residues), 76.9 bits, E=1.3e-25
• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 4 to 430 (427 residues), 553.3 bits, E=2e-170
• PF02817: E3_binding
  • amino acids 135 to 166 (32 residues), 33.3 bits, see alignment (E = 6.6e-12)
• PF00198: 2-oxoacid_dh
  • amino acids 200 to 429 (230 residues), 284.3 bits, E=1e-88

Best Hits

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to rru:Rru_A1214)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

See Q2RV30 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Rru_A1214 Dihydrolipoamide succinyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MATEIIVPQLGESVSEATVAKWFKKVGDAVAADEPLVELETDKVTVEVPAPAAGTLSEII
AAEGAEVAVGAVLALLAGAGEGAAPAKPAAAPAEKKAEPEKKPEAEKKAGPEKKAEPVAA
AAPKAASAPLDYPLPPAVRKLVDDNALDPARIPATGKDGRLTRDDVVAFLKAGAPAGAPA
SAPAPASAPAAGPAREAGPREEKVKMTRLRRRIAERLKEAQNTAAILTTFNEVDMTNLMA
LRNQYKESFEKKHGVKLGFMSFFVKACVKALQEMPAVNSEISGDSLIYKNYYDIGVAVGG
AQGLVVPVVRDCDAKSFATIEADIAGYGKKARDGSLTMEEMAGGTFTVSNGGVYGSLMST
PIINPPQSAILGMHKTMMRPMVMPDGSIAARPMMYLALSYDHRIVDGKEAVTFLVRVKEC
IEDPARLLLDA