Protein Info for Rru_A1212 in Rhodospirillum rubrum S1H

Annotation: Succinyl-CoA ligase, alpha subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 4 to 287 (284 residues), 469.5 bits, see alignment E=2e-145 PF02629: CoA_binding" amino acids 7 to 99 (93 residues), 104.8 bits, see alignment E=5e-34 PF13607: Succ_CoA_lig" amino acids 145 to 281 (137 residues), 36.2 bits, see alignment E=7.6e-13 PF00549: Ligase_CoA" amino acids 151 to 272 (122 residues), 99.8 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 78% identical to SUCD_RICFE: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 100% identity to rru:Rru_A1212)

MetaCyc: 71% identical to succinyl-CoA ligase alpha subunit (Homo sapiens)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; Succinate--CoA ligase (GDP-forming). [EC: 6.2.1.5, 6.2.1.4]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.4 or 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV32 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Rru_A1212 Succinyl-CoA ligase, alpha subunit (NCBI) (Rhodospirillum rubrum S1H)
MSVLVSNDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGSTHLDLPVFDTVIQA
REATGCNATVIYVPPPFAADAILEAINAEIELAVCITEGIPVLDMVKVKRALRGSKTRLI
GPNCPGVITPGECKIGIMPGHIHTRGKIGVVSRSGTLTYEAVAQTTAAGLGQSTCIGIGG
DPVNGTNFIDCLEMFLADPETQGIIMIGEIGGSAEEEAAEFLKHSKIKKPMCGFIAGVTA
PPGKRMGHAGAIISGGKGTAGDKMDAMRSAGILVADSPSALGSTMVEAMKSA