Protein Info for Rru_A1211 in Rhodospirillum rubrum S1H

Annotation: Succinyl-CoA synthetase, beta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01016: succinate-CoA ligase, beta subunit
  • amino acids 1 to 395 (395 residues), 530.9 bits, E=9.2e-164
• PF08442: ATP-grasp_2
  • amino acids 2 to 213 (212 residues), 255.3 bits, E=6.1e-80
• PF13549: ATP-grasp_5
  • amino acids 4 to 226 (223 residues), 40.1 bits, E=4.3e-14
• PF00549: Ligase_CoA
  • amino acids 272 to 392 (121 residues), 128.2 bits, E=3.3e-41

Best Hits

Swiss-Prot: 100% identical to SUCC_RHORT: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 100% identity to rru:Rru_A1211)

MetaCyc: 59% identical to 3-sulfinopropionyl-CoA synthetase beta subunit (Advenella mimigardefordensis DPN7)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; 6.2.1.- [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• TCA cycle V (2-oxoglutarate synthase) (9/9 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (14/17 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• methylaspartate cycle (15/19 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• pyruvate fermentation to acetate VI (3/3 steps found)
• adipate degradation (4/5 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• adipate biosynthesis (3/5 steps found)
• reductive TCA cycle II (8/12 steps found)
• 3,3'-disulfanediyldipropannoate degradation (1/4 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

See Q2RV33 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Rru_A1211 Succinyl-CoA synthetase, beta subunit (NCBI) (Rhodospirillum rubrum S1H)
MNIHEYQAKQVLAKYGVPVLKGGVAYTAEEAEKVALDLAGPVYVVKSQIHAGGRGKGHFK
EPSAGDKGGVRVVKSTDEVFSNAKQMLGATLVTHQSGAEGKEVKRVYIEDGCDIKRELYL
SLLVDRATSAVTVMASTEGGMDIEEVANHSPEKIFFQAIDQATGISGFHCRNVAFSLGLE
GKQVGAFTKLLSALYKCFTETDCSMLEINPLVVTGDGQVIPLDCKMNFDSNALYRHPDIV
EYRDEDEEDPMELEASKHDLNYIKLDGSIGCMVNGAGLAMATMDIIKLKGGAPANFLDVG
GGATRERVTAAFKIILSDPNVDGILVNIFGGIMRCDVIAEGVIAAAREVSLNVPLVVRLE
GTNVELGKKIMVESGLPIISADNLADAAEKVVKAVKEAS