Protein Info for Rru_A1186 in Rhodospirillum rubrum S1H

Annotation: 16S rRNA processing protein RimM (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02273: 16S rRNA processing protein RimM" amino acids 5 to 167 (163 residues), 136.7 bits, see alignment E=2.6e-44 PF01782: RimM" amino acids 7 to 85 (79 residues), 62.8 bits, see alignment E=4.6e-21 PF05239: PRC" amino acids 94 to 168 (75 residues), 41.6 bits, see alignment E=1.5e-14 PF24986: PRC_RimM" amino acids 100 to 168 (69 residues), 62 bits, see alignment E=5e-21

Best Hits

Swiss-Prot: 100% identical to RIMM_RHORT: Ribosome maturation factor RimM (rimM) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 100% identity to rru:Rru_A1186)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV58 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Rru_A1186 16S rRNA processing protein RimM (NCBI) (Rhodospirillum rubrum S1H)
MTERLLVGVIVGSHGVRGLVRVKSFTQDEMALCDYGPLSDETGTRRFAVEVRNQAKGVVI
CQIPGVSDRTAADALKGTRLFLDRAALPADALEEDEYYHADLIGLPVDLVDGGRLGVVHS
VHDFGAGDMLEVTLAQGRRSVLLPFTKAVVPLVDVKAGRLVADPPLGLLDDTRPPAGVEG
EVEEDPGVGIDEDGDGKGGAS