Protein Info for Rru_A1180 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 350 (328 residues), 54.2 bits, see alignment E=5.7e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1180)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV64 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Rru_A1180 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MMDQRTALGEAQGRRARGAVGVLFLTNGMALGLWSALIPGVKQGLALSDGRLGIALLAMA
IGALVAMPLTGVLVARFGSAMVGRCAALVFFAVLPLPVIAPSLPLLVAALIVLGGANGVL
DVAMNAHGVLVEGRLGRPVMSSFHGMFSLGGLIGAGVGGGLLVWAGGPALALGLACVAAL
AVLAGWGRLLPASADIGSHAGAGFALPRRGTLVLGLLAFAVLMSEGAMLDWSAVHLRESL
GAGAALGGAGYAAFSAAMAVGRFSGDALRRRLGSVVLTRGGGVIAAVGLGAGLMVGTPGA
MIAGFACAGIGFANMVPVLFGAAGRVPGAAPATSITAVATLGYAGFLVGPPLIGAVAEAT
RLGQALGLAVLAGLLVALAAGVTRVADGHGKGA