Protein Info for Rru_A1163 in Rhodospirillum rubrum S1H

Annotation: Nickel-dependent hydrogenase b-type cytochrome subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details TIGR02125: Ni/Fe-hydrogenase, b-type cytochrome subunit" amino acids 23 to 235 (213 residues), 218.6 bits, see alignment E=3.5e-69 PF01292: Ni_hydr_CYTB" amino acids 25 to 230 (206 residues), 103.2 bits, see alignment E=7.7e-34

Best Hits

Swiss-Prot: 60% identical to CYBH_AZOCH: Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hupZ) from Azotobacter chroococcum mcd 1

KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 100% identity to rru:Rru_A1163)

MetaCyc: 56% identical to hydrogenase b-type cytochrome subunit (Cupriavidus necator)
Hydrogenase (acceptor). [EC: 1.12.99.6]

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV81 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Rru_A1163 Nickel-dependent hydrogenase b-type cytochrome subunit (NCBI) (Rhodospirillum rubrum S1H)
MSTVTDEAAPEVILGTTRHPSVYIYEAPVRLWHWLNAACIVVLAVTGYLIGSPPPSLAGD
AGGVFRFGALRFAHFAAGLLFAGGFVFRAYWAFVGNHYARQLFVLPFWRAVWWREIWFEL
SWYLFLRKEPKKYLGHNPLAHFMMFFLFTLVGLFMIVSGMALYAEGQGPGSWTRGLFGWV
FWLFPNTQDLRTLHHLGLWVMVCFTMLHVYAAIREDIMSRQSMLSTMISGRRMFKDDRP