Protein Info for Rru_A1156 in Rhodospirillum rubrum S1H

Annotation: Potassium-translocating P-type ATPase B subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 250 to 276 (27 residues), see Phobius details amino acids 584 to 602 (19 residues), see Phobius details amino acids 616 to 636 (21 residues), see Phobius details amino acids 655 to 679 (25 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 8 to 677 (670 residues), 1027.2 bits, see alignment E=0 TIGR01494: HAD ATPase, P-type, family IC" amino acids 74 to 346 (273 residues), 105.9 bits, see alignment E=1.7e-34 amino acids 371 to 601 (231 residues), 149.6 bits, see alignment E=9.8e-48 PF00122: E1-E2_ATPase" amino acids 117 to 209 (93 residues), 64.5 bits, see alignment E=9.8e-22 PF00702: Hydrolase" amino acids 302 to 530 (229 residues), 91 bits, see alignment E=2.1e-29 PF12710: HAD" amino acids 437 to 526 (90 residues), 28.8 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 69% identical to KDPB_AGRFC: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to rru:Rru_A1156)

MetaCyc: 67% identical to K+ transporting P-type ATPase subunit KdpB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV88 at UniProt or InterPro

Protein Sequence (682 amino acids)

>Rru_A1156 Potassium-translocating P-type ATPase B subunit (NCBI) (Rhodospirillum rubrum S1H)
MSIHRPRHAALFERALVVPAARNAVLKLDPRSLIANPVMFVTAVVAVLSTVLFVRDLIHG
LGPVAVEGQIALWLWFTVLFANFAEAMAEGRGKAQADSLRKTRTETLARKLSSPTATAEQ
SVSAASLRSGDLVVCEAGDVIPGDGDVIVGIATVDESPITGESAPVIRESGGDRSAVTGG
TRVVSDRIVVRITVNPGESFLDRMINLVEGAKRQKTPNEIALTILLVGLTLIFLLVVASL
PAFAAFSGAMIPVVFLLALFVTLIPTTIGGLLSAIGIAGMDRLVTFNVIAKSGRAVEAAG
DIDVLLLDKTGTITLGSRQAAEFLPVSGINERDLAEAAFLSSLEDQTPEGKSIVALARQR
FGFTGGEGTAMRFIPFTAQTRMSGVDFGDSEIRKGASDAVLAYLQAHGGPGAARDLVSAV
ERVAKSGGTPLVVARDNRALGVVHLKDIVKPGIRERFATLRDMGIRTVMVTGDNPLTAAA
IAAEAGVDDVLAEATPERKLELIRKEQAEGRLVAMCGDGSNDAPALAQADVGVAMNTGTQ
AAREAGNMVDLESDPTKLIEIVMIGKQLLMSRGSLTTFSIANDVAKYFAIIPALFLASFP
QLQALNVMGLSSPQSAILSAIIFNALVIIALIPLALKGVAYRPAAAADLLRRNLLIYGLG
GLAAPFIGIKVIDMLVTAVGLA