Protein Info for Rru_A1155 in Rhodospirillum rubrum S1H

Annotation: Potassium-transporting ATPase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 376 to 402 (27 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 490 to 512 (23 residues), see Phobius details amino acids 531 to 555 (25 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 562 (562 residues), 774.1 bits, see alignment E=4.2e-237 PF03814: KdpA" amino acids 11 to 561 (551 residues), 827.2 bits, see alignment E=2.4e-253

Best Hits

Swiss-Prot: 100% identical to KDPA_RHORT: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to rru:Rru_A1155)

MetaCyc: 54% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV89 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Rru_A1155 Potassium-transporting ATPase (NCBI) (Rhodospirillum rubrum S1H)
MDANAILQVVLFCAIILGLTPLLGGYMARVFSGERVLLSVVFGPLERGLYRLSGVRPKEE
QHWAAYALSMLVFNLAGLLGLYLILRVQGWLPLNPAGLGAVAPDLAFNTAVSFVTNTNWQ
AYGGESTLSYFSQMVGLTVQNFVSAATGIAVLVALIRGFARRSARTLGNFWVDLTRTVLY
LLLPLAFVTALVLVWQGAPQTLGDYVQAAPLEGGSQVIALGPVASQEAIKQLGSNGGGFF
SVNSAHPFENPTPLSNLIEMVLLLAVAAGLTNTFGRMVGDTRQGWALFAAMSLMFVVGLG
VTLWQESAANPAMVVAGIEAGGGNMEGKEVRLGVANSAIWAVATTAASNGSVNAMHDSFM
PLAGMVPMINMMLGEVIFGGVGAGLYGMLIFVMVTVFIAGLMVGRTPEYLGKKIEAREMK
LAVISLLVPPLCILGFGAVALTWPQAAASVQDPGPHGLTEALYAYVSGTANNGSAFAGFA
ANVFPHNLMIGLAMLIGRFLVILPVLAIAGSLGAKKIVPVSAGTFPTHGGLFIGLLVGVI
VVVGGLTYFPVLALGPILEQLMLRSGSLF