Protein Info for Rru_A1137 in Rhodospirillum rubrum S1H

Annotation: transport system permease protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 70 to 94 (25 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 245 to 274 (30 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF01032: FecCD" amino acids 23 to 337 (315 residues), 272.8 bits, see alignment E=3.3e-85 PF00950: ABC-3" amino acids 120 to 310 (191 residues), 24.1 bits, see alignment E=2.4e-09

Best Hits

Swiss-Prot: 41% identical to YVRB_BACSU: Uncharacterized ABC transporter permease protein YvrB (yvrB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to rru:Rru_A1137)

Predicted SEED Role

"Copper ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVA7 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Rru_A1137 transport system permease protein (NCBI) (Rhodospirillum rubrum S1H)
MKVGPAALRITAICLLAVVVLGVALAAGAALGEAPIPLVTVIEVVANKVLGAGYALDPID
EGIIWNYRVARALVAASCGASLAVSGVVLQSLLLNALADPYILGISAGASSGAVAVAVLG
LGGGLVSLSVGAFLGAVLAFALVSFIALKAGRGPAAIILAGIAGSQLFNALTSFVVTKVA
TADQARGIMFWLLGNLSGVRWPDVSLAVPVALGGLVICLFYARALDAFAFGADSAASLGI
PVRRVYIMMIAIAAGTTATMVSIVGSIGFVGLVIPHVARLTVGVRHNKVLPAAALIGAIF
MIAADILSRKIIPGQVLPIGVMTALVGAPAFALILMRRPAHR