Protein Info for Rru_A1120 in Rhodospirillum rubrum S1H

Annotation: ABC transporter, transmembrane region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 43 to 315 (273 residues), 136.4 bits, see alignment E=1.6e-43 PF00005: ABC_tran" amino acids 378 to 527 (150 residues), 113.9 bits, see alignment E=9.6e-37

Best Hits

Swiss-Prot: 52% identical to ATM1_NOVAD: ATM1-type heavy metal exporter (atm1) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rru:Rru_A1120)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVC4 at UniProt or InterPro

Protein Sequence (617 amino acids)

>Rru_A1120 ABC transporter, transmembrane region (NCBI) (Rhodospirillum rubrum S1H)
MRRPASTLPPPTTSGAVRDWRVIARLLPHLWPADAPALRLRLVLSMGVLLLAKLAGVVVP
LFYKHAVDALSVPERAAIVLPLGVIAAYGLARLGNLAFTEIRDLLFARVIERAIHVLSLR
TFRHLHGLSLRFHLDRQTGGLSRVIERGTRAIEVVLRQFVLRAGPSLIELVMVCGVLWTL
YDWTYAVVMVGALAVYVAWTLAITEWRLDFRRSMNTHDAEASSKAIDSLINYETVKYFGN
EEHEAKRFDRALSAYEEVAVKSHRSLSLLNVGQSAIISLSLVAVMIMAAVDIRGGRMTPG
DFVLVNTYLLQLYVPLNFLGMVYREVKQGLVDMEVLFGLIDRPPEVADPANAADLVVRGG
AVRFEGVRFAYNPEREVLKGVSLEIPAGGTLAVVGHSGAGKSTLSRLLFRFYDVTGGRVL
IDGQDLRDVTQASLRRAIGIVPQDTVLFNDTIGYNIAYGRPGASRQEVERAARLAAIHDF
VQSLKNGYDTQVGERGLKLSGGEKQRVAIARTILKDPAILILDEATSALDSHTEREIQGA
LRDVSRGRTTLVIAHRLSTVIDADRILVLDGGRVAESGSHDDLLRAEGLYAALWRKQQQS
SSLAVDEEADTILPAPA