Protein Info for Rru_A1110 in Rhodospirillum rubrum S1H

Annotation: Sigma 32 (RpoH) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR02392: alternative sigma factor RpoH" amino acids 15 to 283 (269 residues), 378.3 bits, see alignment E=2.5e-117 PF00140: Sigma70_r1_2" amino acids 16 to 43 (28 residues), 26.9 bits, see alignment (E = 5.7e-10) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 48 to 282 (235 residues), 107.8 bits, see alignment E=4.5e-35 PF04542: Sigma70_r2" amino acids 53 to 118 (66 residues), 65.7 bits, see alignment E=4e-22 PF04545: Sigma70_r4" amino acids 230 to 281 (52 residues), 61 bits, see alignment 9.5e-21

Best Hits

Swiss-Prot: 70% identical to RPOH_CAUVC: RNA polymerase sigma factor RpoH (rpoH) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to rru:Rru_A1110)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVD4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Rru_A1110 Sigma 32 (RpoH) (NCBI) (Rhodospirillum rubrum S1H)
MATVAPGLSIGPESNLTRYLQNIRKFPMLAPEEEYTLAQRLRDSGDSEAAHRLVTSHLRL
VAKIAMGYRGYGLPMGEVISEGNVGLMQAVKRFDPERGFRLATYAMWWIRAAIQEYILHS
WSLVKMGTTAAQKKLFFNLRKMKGQLQLMDEGDMHPDKVTQIATKLGVPEQDVINMNRRL
SSPDHSLNAPVRMDGDGEWQDWLVDESDDQETTLAESQEMGQRRALLSGALKSLNERERH
ILTQRRLRDDPVTLEDLSQHYGISRERVRQIEVRAFEKLQKWMHGAMTGAAPAVAAVAC