Protein Info for Rru_A1103 in Rhodospirillum rubrum S1H

Annotation: Phenazine biosynthesis PhzC/PhzF protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR00654: phenazine biosynthesis protein, PhzF family" amino acids 12 to 252 (241 residues), 125.4 bits, see alignment E=1.5e-40 PF02567: PhzC-PhzF" amino acids 18 to 273 (256 residues), 178.1 bits, see alignment E=1.4e-56

Best Hits

Swiss-Prot: 46% identical to YX21_CAUVC: Uncharacterized isomerase CC_3221 (CC_3221) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06998, (no description) (inferred from 100% identity to rru:Rru_A1103)

Predicted SEED Role

"Phenazine biosynthesis protein PhzF like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVE1 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Rru_A1103 Phenazine biosynthesis PhzC/PhzF protein (NCBI) (Rhodospirillum rubrum S1H)
MTAAFAAGPRLRVPFFQVDAFADVAFAGNPAAVCLLEKAWPEDELLQAIAAENNLSETAF
VVRGGENHALRWFTPLTEVPLCGHATLASGHVLLRELGACGPQRFDTRAGMLEVSATDEG
ALAMRLPAKPPKSAIFPEDLDRVLGVRPMEVAQGGGFLIVVLGGVEAVRGLRPRLSMLRA
LGIPKLVVTAAGGGADSADACDFASRVFAPGVGIDEDPVTGSAHCVLTPFWAKRLGRDRL
LAHQVSPRGGRLVCTLMGAEVEMIGQAVTVISGTLSV