Protein Info for Rru_A1102 in Rhodospirillum rubrum S1H

Annotation: Phosphomethylpyrimidine kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • amino acids 6 to 259 (254 residues), 316.6 bits, E=5.1e-99
• PF01256: Carb_kinase
  • amino acids 6 to 243 (238 residues), 28.6 bits, E=1.5e-10
• PF08543: Phos_pyr_kin
  • amino acids 13 to 258 (246 residues), 312.4 bits, E=3e-97
• PF00294: PfkB
  • amino acids 121 to 238 (118 residues), 43.2 bits, E=4.9e-15

Best Hits

Swiss-Prot: 49% identical to THID_STRCO: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to rru:Rru_A1102)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
• hydroxymethylpyrimidine salvage (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.7

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

See Q2RVE2 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Rru_A1102 Phosphomethylpyrimidine kinase (NCBI) (Rhodospirillum rubrum S1H)
MTQGRVLIIAGSDSSGGAGIQADLKAVMALGGYGATAIAALTAQNTRGVEGIHAVPPAFV
RQQMALFLDDIGADALKIGMLATAEVIEAVADEIELRAAGLPLVVDPVMVAKGGHRLLEE
SATAALIARLLPIARVLTPNLPEAEVLVGFSIADEAAMEKAGRALLERGPQAVLMKGGHL
EGDDLVDLLVTAEGTVRFRASRLQTTSTHGTGCTLASAIACGLAQGRSVEQAIARARAYV
RKAMETAPGLGHGHGPLNHGFTVSPFEVPLP