Protein Info for Rru_A1100 in Rhodospirillum rubrum S1H

Annotation: Phosphoglucosamine mutase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 62 to 80 (19 residues), see Phobius details PF02878: PGM_PMM_I" amino acids 5 to 137 (133 residues), 159.6 bits, see alignment E=7.5e-51 TIGR01455: phosphoglucosamine mutase" amino acids 7 to 448 (442 residues), 613.6 bits, see alignment E=9.4e-189 PF02879: PGM_PMM_II" amino acids 160 to 257 (98 residues), 60.1 bits, see alignment E=5.5e-20 PF02880: PGM_PMM_III" amino acids 261 to 370 (110 residues), 127.4 bits, see alignment E=5.9e-41 PF00408: PGM_PMM_IV" amino acids 379 to 444 (66 residues), 54.6 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 100% identical to GLMM_RHORT: Phosphoglucosamine mutase (glmM) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to rru:Rru_A1100)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVE4 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Rru_A1100 Phosphoglucosamine mutase (NCBI) (Rhodospirillum rubrum S1H)
MAKRTLFGTDGVRGTANREPMTADTALRIGMAAGHLLRNGDHRHTVVIGKDTRLSGYMLE
PALAAGFISVGMDVVLLGPLPTPAVAMLTRSLRADLGVMITASHNPFQDNGIKLFGPDGY
KLSDDQEATIEALLDNGLEGHRAGPTALGKARRLDDCNGRYVEFVKSTFPRGRRLEGLRI
VVDCAHGAAYRVAPKVLWELGATIVPIGVTPDGTNINKDCGSLHSRVMCETVVREGADLG
VALDGDADRVVLCDEKGALVDGDQLLALIGRNWKRAGTLQGGGVVATVMSNLGLERFLKD
EGLALARTPVGDRYVVEHMRAEGYNLGGEQSGHIVMSDFGTTGDGLMAALQVLSALVAED
RPASEVLDVFTPLPQLLRNVRVAGHDPRAILADPQVARAVSAGEGRLNGGGRLLIRKSGT
EPLIRVMAEGEDEALVAQVVGDICAVIETASQ