Protein Info for Rru_A1096 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13525: YfiO" amino acids 153 to 222 (70 residues), 25.5 bits, see alignment E=2.7e-09 TIGR02795: tol-pal system protein YbgF" amino acids 155 to 269 (115 residues), 121.2 bits, see alignment E=1.8e-39 PF13432: TPR_16" amino acids 164 to 215 (52 residues), 35 bits, see alignment 3.8e-12 PF13174: TPR_6" amino acids 194 to 216 (23 residues), 13.7 bits, see alignment (E = 2.2e-05) amino acids 230 to 261 (32 residues), 25.7 bits, see alignment 3.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1096)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVE8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Rru_A1096 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MSSLALRSPALALALTLGGLLLCGPVQAQQANSANDMVGRMQYRISELERLVQDLTGKVE
QSLYENRQLQTKLENAQSDIDFRLNALESAGPAAAAPANSVPSSARPTASAGAGKQGTPA
PAEGVLGFPGKTAPAQGAASAARPAAAGALPAGSENDQYNYAFSLLRNADYPAAEQAFKA
FLDQHPKGSLAGNAQYWLGETYYVRGDYEQAAVAFMGGYQSHPDSSKGPDNLLKLGLAMA
NLGKSKEACAAFGRLESQYPKAADAIKRRAKEGMSKLGC