Protein Info for Rru_A1094 in Rhodospirillum rubrum S1H

Annotation: TolB protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 24 to 439 (416 residues), 478 bits, see alignment E=1.3e-147 PF04052: TolB_N" amino acids 34 to 140 (107 residues), 120.5 bits, see alignment E=6.8e-39 PF07676: PD40" amino acids 251 to 283 (33 residues), 17.5 bits, see alignment (E = 6.6e-07) amino acids 294 to 328 (35 residues), 44.4 bits, see alignment 2.3e-15 amino acids 382 to 411 (30 residues), 14.6 bits, see alignment (E = 5.3e-06)

Best Hits

Swiss-Prot: 100% identical to TOLB_RHORT: Tol-Pal system protein TolB (tolB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to rru:Rru_A1094)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVF0 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Rru_A1094 TolB protein (NCBI) (Rhodospirillum rubrum S1H)
MTRLAKGKWRSTLGAMMALAVMVAAIPQARAELVIDITRGVREPMPIAIPVFGGTDAQSS
AMGRDVVGVVSNDLQGSGLFRVLDPAAYIQSLPNLAVQPQFADWRAINAQALVQGEVQPQ
GDGRLRVAFRLWDVFSGQQVVGRAFLTQGDNWRRVSHIIADEIYKAITGEEGYFDTRVVY
VAETGPKTNRVKKLAIMDQDGANQRNLTNGESMVLTPRFSPTAQEITYLSYYNSVPRVYL
FNIETGRRELLGDFPGMTFAPRFSPDGNKVIMSMALDGNTEIYEMDLRTRRSSRLTNHPS
IDTSPSYAPDGRQITFNSDRGGAQQIYVMNADGSGVQRISFGDGRYATPVWSPRGDLIAF
TKLKGGRFFIGAMRPDGSGEKILTEGFLVEGPTWAPNGRVLMFFRQDPNGRTTLHSIDVT
GYNERQISTPTEASDPAWSPLLP