Protein Info for Rru_A1084 in Rhodospirillum rubrum S1H

Annotation: 5-formyltetrahydrofolate cyclo-ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 122 to 138 (17 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 194 to 209 (16 residues), see Phobius details TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 88 to 232 (145 residues), 132 bits, see alignment E=1.2e-42 PF01812: 5-FTHF_cyc-lig" amino acids 96 to 232 (137 residues), 95.4 bits, see alignment E=2.1e-31

Best Hits

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 100% identity to rru:Rru_A1084)

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVG0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Rru_A1084 5-formyltetrahydrofolate cyclo-ligase (NCBI) (Rhodospirillum rubrum S1H)
MVPPTDPFPDSEPEGTDPPSSGGASAPSSPPSFATVKAGLRAQARRTRKGLADAAGAAGD
KAPGAPLSRATPAGAAAFHGAADLLSRLTTPHETIIAGYWPMAGELDPRPLMAALHAHGC
RLALPVVVGPASALAFRAWAPGEPVDQGALGTFQPLSLAPLVTPSWLLVPLLAFDDAGHR
LGQGGGFYDRTLAGLGAAGSPVVAIGVAYAAQQVEALPVEPHDRPLDGVITEAGVRWFGE
WPRPDMERKR