Protein Info for Rru_A1080 in Rhodospirillum rubrum S1H

Annotation: Thiamine-phosphate diphosphorylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 7 to 200 (194 residues), 178.3 bits, E=5.5e-57
• PF02581: TMP-TENI
  • amino acids 8 to 189 (182 residues), 187.2 bits, E=9.4e-60

Best Hits

Swiss-Prot: 70% identical to THIE_RHOCS: Thiamine-phosphate synthase (thiE) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to rru:Rru_A1080)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See Q2RVG4 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Rru_A1080 Thiamine-phosphate diphosphorylase (NCBI) (Rhodospirillum rubrum S1H)
MSDPACRLYLITPPRLDDWAAFAETLKRTLAAGDVACLQLRMKDESDDAIRRAVAAIRPV
CHGADVALLLNDRPDLAKETGCDGVHVGQTDASYAQARAIVGADAIVGVTCHDSRHLAMI
AGEAGADYVAFGAFFPSTTKEPPTQADPEILRWWSEMMIVPSVAIGGITVENCAPLVETG
TDFLAVCNGVWGHAEGPEAAVRAFVRVIAEVYAQPD