Protein Info for Rru_A1070 in Rhodospirillum rubrum S1H

Annotation: Heat shock protein Hsp20 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00011: HSP20" amino acids 43 to 140 (98 residues), 68.1 bits, see alignment E=3.2e-23

Best Hits

Swiss-Prot: 42% identical to HSPA_BRADU: Small heat shock protein HspA (hspA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 100% identity to rru:Rru_A1070)

Predicted SEED Role

"16 kDa heat shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVH4 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Rru_A1070 Heat shock protein Hsp20 (NCBI) (Rhodospirillum rubrum S1H)
MRTFDLAPLHRFAIGFDNVSRLLDAAARLDDQSVAYPPYNIEKTGESAYRITMAVAGFGE
SDLDVVVQENTLVISGKQDKGAEPEVGQFLHRGIAGRAFERKFELADHIKVTGAALVNGL
LHIDLVREVPEEKQPRKIAIASTQAESPKVIENKAA