Protein Info for Rru_A1064 in Rhodospirillum rubrum S1H

Annotation: Plasmid maintenance system killer (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF05015: HigB-like_toxin" amino acids 5 to 95 (91 residues), 100.5 bits, see alignment E=3e-33

Best Hits

Swiss-Prot: 50% identical to HIGB1_VIBCH: Toxin HigB-1 (higB-1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07334, proteic killer suppression protein (inferred from 100% identity to rru:Rru_A1064)

Predicted SEED Role

"HigB toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVI0 at UniProt or InterPro

Protein Sequence (98 amino acids)

>Rru_A1064 Plasmid maintenance system killer (NCBI) (Rhodospirillum rubrum S1H)
MIVGFRDEWLRAFFVEDIHCRSIPADLESRLFRKLQMIDDAMTDQDLRVPPSNHFEKLHG
ILDGLYSIRVNKQWRLIFRWDGGRGEASGIYLDDHGYR