Protein Info for Rru_A1046 in Rhodospirillum rubrum S1H

Annotation: AMP-dependent synthetase and ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16177: ACAS_N
  • amino acids 5 to 59 (55 residues), 87.3 bits, 6.9e-29
• PF00501: AMP-binding
  • amino acids 66 to 446 (381 residues), 247.5 bits, E=3.1e-77
• PF13193: AMP-binding_C
  • amino acids 512 to 590 (79 residues), 88 bits, E=9.7e-29

Best Hits

Swiss-Prot: 57% identical to Y3568_PSEAE: Uncharacterized protein PA3568 (PA3568) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01908, propionyl-CoA synthetase [EC: 6.2.1.17] (inferred from 100% identity to rru:Rru_A1046)

MetaCyc: 66% identical to propionate--CoA ligase (Ruegeria pomeroyi DSS-3)
Propionate--CoA ligase. [EC: 6.2.1.17]

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

• 2-methylcitrate cycle I (5/5 steps found)
• acrylate degradation II (3/3 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• β-alanine biosynthesis II (4/6 steps found)
• 2-methylcitrate cycle II (4/6 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• chitin deacetylation (1/4 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (2/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1

Use Curated BLAST to search for 6.2.1.1 or 6.2.1.17

Sequence Analysis Tools

See Q2RVJ8 at UniProt or InterPro

Protein Sequence (634 amino acids)

>Rru_A1046 AMP-dependent synthetase and ligase (NCBI) (Rhodospirillum rubrum S1H)
MTNAYEEAYQRSITDKEGFWGDAARDIVWTKPWDRVLDESQAPLYRWFAGGELNTCYNAV
DRHVDEGRGDQAAIIYDSAITGAKRTISYKTLKDQVAGFAGVLASRGVGKGDRVILYMPM
IPESLVAMLACARLGAIHSVVFGGFAPNELATRINDAQPKAIVAASCGIEPNRVIAYKPL
VDEAIRLSAHKPDSVIVWQREEARADLSNPGDIDWALALETTTPHDCVPVAATDPLYILY
TSGTTGQPKGVVRDNGGHAVALRWTMKAIYNMSPGDVFWAASDVGWVVGHSYICYAPLLL
GATTLVFEGKPVGTPDAGTFWRVIAEHKVATLFTAPTAFRAIKREDPDGLEIGKYDLSSL
RALFLAGERCDPATIDWAEHKLGVPVIDHWWQTETGWAIAANCLGLHLYPVKHGSPTLAA
PGWDVRVLDDTNHEVNPGQIGALVCKLPLPPGTLTTLWNAEARFRQAYLADFPGYYKSGD
AGFIDDEGYIYVMTRTDDIINVAGHRLSTGAMEEVLAGHPAVAECAVIGISDDLKGQVPL
GFVCLKAGITTEPAQIAKECAALVRDQIGPVAAYKQTVVVPRLPKTRSGKILRGTMQKIA
DNEAFKMPATIDDPGILPEIEEALESIGLARKRV