Protein Info for Rru_A1034 in Rhodospirillum rubrum S1H

Annotation: Multi-sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 transmembrane" amino acids 312 to 335 (24 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 401 to 509 (109 residues), 36.4 bits, see alignment E=2.6e-13 PF00989: PAS" amino acids 403 to 498 (96 residues), 26.1 bits, see alignment E=1.9e-09 PF13188: PAS_8" amino acids 403 to 446 (44 residues), 25.8 bits, see alignment 1.8e-09 PF08448: PAS_4" amino acids 407 to 510 (104 residues), 24.2 bits, see alignment E=8.4e-09 PF13426: PAS_9" amino acids 412 to 509 (98 residues), 30.6 bits, see alignment E=8.4e-11 PF02518: HATPase_c" amino acids 626 to 752 (127 residues), 33.4 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1034)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVL0 at UniProt or InterPro

Protein Sequence (753 amino acids)

>Rru_A1034 Multi-sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MIPIFKAWAARKRSSEPTAGQSEFDLADPFVAFSDSDSAPPSAEPPSFGPPAAALPPVLT
KGDGEGTEDPLVAWRAEESPRRRTDPPPAERRHDPFLGGSFGGAGDAVAEEVSRALSWDE
AEKTGGRVGEGEADTLDPVDEDDLYEPLSATPRDPDAPRIARDPPSPLGVDPLEAPRREA
EDHREFSIPRSEPLAPFLLPPLPEDPLATSPSREGRPPRQGVDKSDDPAAMAPLAAAAPV
ERPSGQTGRREPPLADIADASDSEPPEEEDRADEQQASLGPGLGEGAAHGMPAFLAEPAS
ARSEARTRLDPVACGLLGLMVSLGPLGVAAGTVLATGRMPTDRWTLAAAGGLAGLFLVCA
GLAAWGIWRHLGGRITRLSAQIEATDQRGRFLGRQARAAKAYLSGVLDGAPLAIVTLDGR
GTIIGLNPAAEALFGYPLPRAVGRPLSLLTAAGEDGGPPWPAPTGEEEGPRRVEGRRADG
SVFPAELSLRALRRENGGGLVVLFLHDLSAEGGAKSLAESGRAESAFLDVLASELVVPVE
AMALALRSSHPDLERVEQALSLLGQIATDVRGFANLEAGRVALEFAPVEVRAVCTRARAA
VLAPAAEFGLKVGVSVAPDTPETILGDEALLETVLTNLLDCALQFNALDPAAHAALPGSI
TLSVRPLDNPPGRLRIEVGCPASEGGRDGLDPASRRRGPILPGARLRLEPVGSRGRTGTI
LVITRRLAELMGGRVGMESFPGRGTVLWFELDD