Protein Info for Rru_A1031 in Rhodospirillum rubrum S1H

Annotation: Ethanolamine ammonia-lyase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF05985: EutC" amino acids 8 to 241 (234 residues), 296.1 bits, see alignment E=8.4e-93

Best Hits

Swiss-Prot: 54% identical to EUTC_RHOP5: Ethanolamine ammonia-lyase light chain (eutC) from Rhodopseudomonas palustris (strain BisA53)

KEGG orthology group: K03736, ethanolamine ammonia-lyase small subunit [EC: 4.3.1.7] (inferred from 100% identity to rru:Rru_A1031)

Predicted SEED Role

"Ethanolamine ammonia-lyase light chain (EC 4.3.1.7)" in subsystem Ethanolamine utilization (EC 4.3.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.7

Use Curated BLAST to search for 4.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVL3 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Rru_A1031 Ethanolamine ammonia-lyase (NCBI) (Rhodospirillum rubrum S1H)
MTLPPVVDPFARFRAATRARVGLGRSGDALPTTALLEFQIAHARARDAVHGAIDAEALAR
AFAPLPTATVHSAASDRAVYLRRPDLGRRLDDESAARLDALGEGGQGWDVVFVIADGLSA
AAVAAHAQATVRAALETLGGRLSVGPLVIASQSRVALGDDIGARLKARMVAVLIGERPGL
SVADSLGAYITFDPRPGRRDSERNCISNIHADGLHADQAARTLCWLVEEGLRRRITGIGL
KEEAQPRLGAGEGGNLPPVLDPSDRLGELSS