Protein Info for Rru_A1026 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, MerR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF13411: MerR_1" amino acids 6 to 71 (66 residues), 71.9 bits, see alignment E=5.9e-24 PF00376: MerR" amino acids 6 to 42 (37 residues), 54.8 bits, see alignment E=9.9e-19 PF09278: MerR-DNA-bind" amino acids 47 to 110 (64 residues), 72.6 bits, see alignment E=4.9e-24

Best Hits

Swiss-Prot: 38% identical to ZNTR_ECOLI: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1026)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVL8 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Rru_A1026 Transcriptional Regulator, MerR family (NCBI) (Rhodospirillum rubrum S1H)
MTSLAIGALSAQTGVKSPTIRYYEEIGLLPSPPRTDGNRRVYSVETVRRLKFIRHARELG
FEVEAIRQLLALADDPQGSCAPADGIALAHLRDIDSRIDRLTALRDEVRRMVNECAHGPI
GACKVIEVLADHTECLHDHH