Protein Info for Rru_A1005 in Rhodospirillum rubrum S1H

Annotation: Glycosyl transferase, family 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 257 to 284 (28 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 26 to 155 (130 residues), 29.4 bits, see alignment E=6.8e-11 PF00535: Glycos_transf_2" amino acids 30 to 190 (161 residues), 110 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 100% identity to rru:Rru_A1005)

Predicted SEED Role

"Glycosyl transferase, family 2"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVN9 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Rru_A1005 Glycosyl transferase, family 2 (NCBI) (Rhodospirillum rubrum S1H)
MNASPDVSPSAPTVPPVTPSASGADPELLSVIIPLYNEEENVARLCEAVFGALRDMARPF
EVIMVDDGSSDGTVARLETLAPSYPELTVVTFKRNVGQTAAIMAGIDHSHGAIIVPMDGD
LQNDPRDIPILLEKMKEGYDVVSGWRKDRQDDALTRNFPSAVANWLISTISGVHLKDYGC
TLKAYRREVLSGYRLYGEMHRFVPIYARWQGAKITEIPVRHHARTAGQSKYGLNRIFKVL
LDLMVVKFLTQYETKPIYIFGGMGFLLFLGAILSAGGGIALRVIEGIHLNRTPLPLISAM
CVITGMMCILLGLVAELLVRIYFESQDKTAYTVKTVIRGKGGKG