Protein Info for Rru_A1002 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details amino acids 75 to 85 (11 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 266 to 298 (33 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 155 to 251 (97 residues), 69.8 bits, see alignment E=1.1e-23 PF00528: BPD_transp_1" amino acids 172 to 359 (188 residues), 70.1 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A1002)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVP2 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Rru_A1002 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MAVFAPKAALPPPVQTTGPIAWIRQNLLSSPFNIALTALALWIVVSGGSSLVTWAILDAT
FIGEGQDACSNGGACWAFIINRLDFFTYGFYPAAERWRVNLGFLMLAVALVPQFITGFSG
RRALGLFGLTALPVITGVLLVGGVFGLRPVDTSQWGGLMLTLVLAYVGIVAALPLGMVLA
LGRRSSMPVVRISCTTFIELWRGVPLISVLFMASVMLPLFLPTGVTFDKLLRALIGITLF
QSAYMAEVIRGGLQAIPRGQFEAASALGLGFWRSTGLIILPQALKLVIPGVVNTFIALFK
DTTLVLIIGLLDILGTVQSAIVDPAWSRVAVEGYIFAGFCFWIFCFGMSRYSQALESKLH
TGHRK