Protein Info for Rru_A0993 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, NifA, Fis Family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 TIGR01817: Nif-specific regulatory protein" amino acids 25 to 600 (576 residues), 687.4 bits, see alignment E=7.7e-211 PF13185: GAF_2" amino acids 40 to 182 (143 residues), 33.6 bits, see alignment E=1.7e-11 PF01590: GAF" amino acids 40 to 181 (142 residues), 51.3 bits, see alignment E=7.4e-17 PF13492: GAF_3" amino acids 40 to 180 (141 residues), 30.2 bits, see alignment E=2.1e-10 PF00158: Sigma54_activat" amino acids 222 to 387 (166 residues), 250.4 bits, see alignment E=3e-78 PF14532: Sigma54_activ_2" amino acids 222 to 392 (171 residues), 72 bits, see alignment E=2.4e-23 PF07728: AAA_5" amino acids 245 to 363 (119 residues), 31.1 bits, see alignment E=8.6e-11 PF02954: HTH_8" amino acids 558 to 592 (35 residues), 45.2 bits, see alignment (E = 2.4e-15)

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 100% identity to rru:Rru_A0993)

Predicted SEED Role

"Nitrogenase (molybdenum-iron)-specific transcriptional regulator NifA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVQ1 at UniProt or InterPro

Protein Sequence (600 amino acids)

>Rru_A0993 Transcriptional Regulator, NifA, Fis Family (NCBI) (Rhodospirillum rubrum S1H)
MPDTAVAGPLFRLPPSPAEDSSLPLLTLYEVSKILGSTLDLEHSLHDVLNVLASYMQMRR
GVVTLKDAQRQLEVVAVSGMTLRNAVEGEARYPLAVAQEVVSTAMPMIVPSMAADPRFAA
FAAEADGLDDEVQSMICVPIKGGVKPFGSLSIERHRDRGTRFKFEHDVRFLTMVATLIAQ
TVSLERRVVGDRDRLIEEKARLEKALPKREKPLKGTILENVVGRSSAMMKISAQVRQIAP
SRATVLLRGESGTGKELIAQAIHYLSPRSDKPFIKVNCAALPETLLESELFGHEKGAFTG
ATTERKGRFEMASGGTLFLDEIGEITVHFQAKLLRVLQEGEFERVGGGKTIKVDVRLVAA
TNKDLEDAVTRGEFRADLYYRINVVPIFLPALRERREDVPLLAQFFLTKFNEENGRSLRF
SEGALTAMGGCNFPGNVRELENCVCRAATLAQDEVIQELGLSCHNDKCLSASLWQRRGSG
RAIGGLAPVTEQNDPDTTSVAWEGDLRPAAPARAGTPPGRGYAGPGESADSPSSPSAPPP
AAAPAAEDGEDESDAGQRERIVHAMEKAGWVQAKAARLLGMTPRQIGYALKKHDIPLKRM