Protein Info for Rru_A0991 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function UPF0126 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details PF03458: Gly_transporter" amino acids 31 to 105 (75 residues), 89.5 bits, see alignment E=5.4e-30 amino acids 116 to 190 (75 residues), 75.6 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 41% identical to Y2382_VIBCH: UPF0126 membrane protein VC_2382 (VC_2382) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0991)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVQ3 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Rru_A0991 Protein of unknown function UPF0126 (NCBI) (Rhodospirillum rubrum S1H)
MALSPTPTVFPFVSRGERGFLERGMDPVLTWLDTFGLIVFAVSGGLVAARKGMDIVGFAL
MATVTGIGGGTFRDMVLGMTPVFWVREPHYLVVCLAVGILTWFVAHRLDSRQRALLWADA
IGIAFFTVVGTQVGLRAEAGISVALLMGVMTACFGGIVRDLLAGEPSLILQREIYITACV
AGACAYLLFDAMGAGEGVSGVVSFCVTFLVRGAALAFGLSLPGYRDKIDRSQGGTGKG