Protein Info for Rru_A0990 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details PF00672: HAMP" amino acids 339 to 389 (51 residues), 41.7 bits, see alignment 1.8e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 393 to 544 (152 residues), 79 bits, see alignment E=1.7e-26 PF00990: GGDEF" amino acids 396 to 545 (150 residues), 103.8 bits, see alignment E=1.2e-33 PF00563: EAL" amino acids 569 to 804 (236 residues), 255.2 bits, see alignment E=8.4e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0990)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVQ4 at UniProt or InterPro

Protein Sequence (826 amino acids)

>Rru_A0990 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) (NCBI) (Rhodospirillum rubrum S1H)
MEPSIQDLRSSASATDPKRPRRLRLGIGTHLWIAFLSIGALSTVVTLIAFNSYNQATATF
KAITHDRLPAIVAVAKLADDSNALLTTLPHVVLVDSAGTLSEHWRDVAEAEERLNRSIAA
VEALPAPNTRLTDFSDLSGRISAQLQILLSALQEARGAQRDILDLATQMDLLHQKVRLLM
ADAGTQGRIPPDSLYLATRLLSLLGEVLASDDANDIAVNAGRIDQSLQRLQASISAKPND
AIAEMNNTLIAIGSGPNGLVARKRLALRAGAVAKDRLRDVRALSRQIGERVQGMLGDTMI
AVDADRQATEKQLHLSKILLAATSATGLLGAILIAWLYVGRAIVARLDRLSYGMREIADG
HLKGSLPIGGKDEIGEMARAVSVFRDAMERIDYLASNDSLTGLLNRHGFLAGGERLLARG
QRRGWLISINLRRFKDVNQMFGHQTGDTILGEVADRLRRLAGPEDLVARLGGDDFALLAL
DPDDEGRALALCRNILAALRPAIVIGHASLDIEACIGFAGWPEDAEDQGSLLRRAELAMQ
QAKNDPGDPICRYRSALSEDLEVRSQVRKDLRAGIIAGELRLLYQPKVDLRSGRVVGMEA
LVRWNHPRHGLIPPARFIPVAETSGLIIPLGEWVLEECCRQLRLWRDDGMSDLKGSVNMS
PVQVFSQDVAALVAEALHTTGLPAEALEIEITEGVFVHDEQRARRRLEGLRALGVGLAID
DFGTGYSALAYLKRLPATSLKIDQSFIREVTDQPEQARLCRAIIGVGHDFGLTVVAEGIE
TAEHLAFLRAEGCDFGQGYYFAKPLEAQDFAKVLRDQPWLTGDAAQ