Protein Info for Rru_A0981 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 31 to 56 (26 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 227 to 255 (29 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF12911: OppC_N" amino acids 28 to 73 (46 residues), 26.7 bits, see alignment 4.1e-10 PF00528: BPD_transp_1" amino acids 128 to 310 (183 residues), 90.2 bits, see alignment E=1.4e-29

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to rru:Rru_A0981)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVR3 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Rru_A0981 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MTSPLSSSAPRPAATDPAPALRRRSLTQRLLANWSVRLGGGVLAILIAMAIAAPWLGTID
PTAMDPGSGNLLPGTQAEFITLAGDSFDHFFLMGSDSLGRDIWSRALFGARVSITVGISV
ALVALVFGMTVGMAAGYFRRLDTVVMRIMDGVMAIPGILFAISLVALFGGTLPTVIAAIA
IPEIPRVGRLVRSVVLTIREEPYVEAAIALDTPTWKILLRHIMPNAVAPLIIQGTYVCAS
AILIEAILSFLGVGLPADMATWGNIMAEGRSQFNQYPHNVLFPGIFLVLTVLSVNILGDG
LRDTLDPKFNKRGG