Protein Info for Rru_A0952 in Rhodospirillum rubrum S1H

Annotation: UDP-N-acetylmuramoylalanine-D-glutamate ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 16 to 461 (446 residues), 360.7 bits, see alignment E=6.5e-112 PF08245: Mur_ligase_M" amino acids 123 to 305 (183 residues), 88.1 bits, see alignment E=8.1e-29

Best Hits

Swiss-Prot: 100% identical to MURD_RHORT: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to rru:Rru_A0952)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVU2 at UniProt or InterPro

Protein Sequence (477 amino acids)

>Rru_A0952 UDP-N-acetylmuramoylalanine-D-glutamate ligase (NCBI) (Rhodospirillum rubrum S1H)
MAKLIPLYQYAGQDLGIMGLGKSGMATARALAGTGTRVHAWDDSPILRDAARAESVPLCD
LTDQTSRTSPWPALQGVVWSPGIPHTFPQPHPVAVIAHERGVPLFCDIDLLARARQDCFF
LGITGTNGKSTTTALIGHILKAARHPVQVGGNLGTPALSFEPLPFHGTYVLELSSYQLEL
VPSLCCDVAVLLNITPDHLARHGGMDGYIAAKRQIFRCGPRPGVAVVCIDDEPSLAIHDA
LCRENGRKVVAVSTRALPRGGVGAVDGQLVDATQGRPRAVADLTTIATLPGAHNWQNAAA
AYAACRQHGIDAKIIVEAMASFPGLPHRQELVAEIDGVRFINDSKATNADAADKALRCYD
TVYWIAGGQPKEGGIVSLEPHFHRMRQAYLIGQAAPAFERTLKGKVPLSQVGTLTRAVTE
AAKAAWRDAIPGAVVLLSPACASWDQFSSFEHRGDIFRELVADLAHTRAAAKPGGRR