Protein Info for Rru_A0949 in Rhodospirillum rubrum S1H

Annotation: UDP-N-acetylmuramate--alanine ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 11 to 459 (449 residues), 532.4 bits, see alignment E=5.3e-164 PF01225: Mur_ligase" amino acids 11 to 108 (98 residues), 107.6 bits, see alignment E=5.2e-35 PF08245: Mur_ligase_M" amino acids 113 to 299 (187 residues), 97.7 bits, see alignment E=1.4e-31 PF02875: Mur_ligase_C" amino acids 321 to 451 (131 residues), 81.8 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 100% identical to MURC_RHORT: UDP-N-acetylmuramate--L-alanine ligase (murC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to rru:Rru_A0949)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVU5 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Rru_A0949 UDP-N-acetylmuramate--alanine ligase (NCBI) (Rhodospirillum rubrum S1H)
MRALPLDIGPLHFVGIGGIGMSGIAEVLHNLGYRVQGSDLSDNANVKRLRDLGIPIAIGH
KAANLGDAQVVVISSAVKASNPEVMDARARFLPVVRRAEMLGELMRLKWSIAVAGTHGKT
TTTSLVAQLLDAAGLDPTVINGGILNARGTNAYLGTGEWMVVEADESDGTFTKLPATISL
VTNIDPEHLDFYGTFDKVREAFRAFIHNLPFYGFACMCIDHPEVQAMIPQLQDRKIITYG
LSPQADIRGANVTLGPRGARFDVILTDRAGGGSRTIEGIRLPMYGRHNVLNALGAIGIAA
EMGIDDAVIRDGLYHFEGVKRRFTRTGDAGGVTVIDDYGHHPVEIAAVLKAARDATEREV
IAVVQPHRYSRLNSLFEDFCTCFNDADQVVVADVYAAGEQPIPGASKEALAEGLKVHGHK
SVHVLTNEQALPELIARIAKPGDLVVCLGAGSISTWANALPKQLEAVQGRRRQTTLAGGA
P