Protein Info for Rru_A0944 in Rhodospirillum rubrum S1H

Annotation: Cell division protein FtsZ (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 TIGR00065: cell division protein FtsZ" amino acids 16 to 329 (314 residues), 412.7 bits, see alignment E=7.3e-128 PF00091: Tubulin" amino acids 19 to 179 (161 residues), 162.9 bits, see alignment E=1.1e-51 PF12327: FtsZ_C" amino acids 228 to 322 (95 residues), 124 bits, see alignment E=2.4e-40

Best Hits

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 100% identity to rru:Rru_A0944)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVV0 at UniProt or InterPro

Protein Sequence (665 amino acids)

>Rru_A0944 Cell division protein FtsZ (NCBI) (Rhodospirillum rubrum S1H)
MAIKITLPEGPETPHLKPRITVVGVGGAGGNAVNNMIDAELAGVDFVVANTDAQALCHSR
TSRRIQLGTEATRGLGAGARPEVGRVAAEEAVEAIAGELQGANMVFITAGMGGGTGTGAA
PVVASVARELGILTVGVVTKPFQFEGAHRMRLAEAGIDELAQFVDTLIIIPNQNLFRVAN
EKTTFADAFKLADDVLYSGVRSVTDLMINPGLINLDFADVRTVMQNMGRAMMGTGEAEGE
RRALEAAEAAIANPLLEDTSMRGARGVLINITGGTDVTLYEVDEAANRIRDEVESDAHII
FGSSLDPSLDGHIRVSVVATGINAEDVARLNGNDPGQAVRAVADPRPEARIVPEVKIARP
AERSHAERIAAAVGAERAGLTAAKAALAGRPPLAGQPAAAYAAEGHDGAPAMVGKSAKAE
KAVRLLESLVLEANAKKDAKAAIAGSAALARPELRPEPRPEPRPPVIAPRGALAPRLSRD
TFIPSPAMEVNARGTAAMAAAQVPSYETRSSDRDVSRAGRLEAPEPEHEPARRPLMSREE
EPIAAYRDDDLDPGEVYVDDVAYDPRPAREFRPALPEGARAAYQAQMRRATEDHPREEPR
APRVEKPSLLARITGLGGRSAGHEHRDGNPLLSAKTLSAQADDRPVASQPDDQLEIPAFL
RRQAN