Protein Info for Rru_A0942 in Rhodospirillum rubrum S1H

Annotation: GreA/GreB family elongation factor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 98 to 118 (21 residues), see Phobius details PF14760: Rnk_N" amino acids 12 to 51 (40 residues), 43 bits, see alignment E=5.2e-15 PF01272: GreA_GreB" amino acids 58 to 133 (76 residues), 78.2 bits, see alignment E=3.7e-26

Best Hits

KEGG orthology group: K06140, regulator of nucleoside diphosphate kinase (inferred from 100% identity to rru:Rru_A0942)

Predicted SEED Role

"Regulator of nucleoside diphosphate kinase" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVV2 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Rru_A0942 GreA/GreB family elongation factor (NCBI) (Rhodospirillum rubrum S1H)
MSTSSSQSVVPPPVVIDHADHERLQGLALRALAGAPDLAGRLLAEIDRARVLPSESVPAD
VVTLGAEVTFRDESTGRVRKVTLVYPGEADIDQGKISIMTPIGVALIGLAVGASIDWLTR
DGDERHLSVLAVRKPE