Protein Info for Rru_A0941 in Rhodospirillum rubrum S1H

Annotation: competence lipoprotein ComL, putative (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 23 to 257 (235 residues), 298.5 bits, see alignment E=1.7e-93 PF13512: TPR_18" amino acids 48 to 175 (128 residues), 63.9 bits, see alignment E=4.5e-21 PF13525: YfiO" amino acids 49 to 243 (195 residues), 198.6 bits, see alignment E=2.6e-62 PF13174: TPR_6" amino acids 126 to 166 (41 residues), 19.2 bits, see alignment 3.9e-07

Best Hits

Swiss-Prot: 50% identical to BAMD_CAUVC: Outer membrane protein assembly factor BamD (bamD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to rru:Rru_A0941)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVV3 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Rru_A0941 competence lipoprotein ComL, putative (NCBI) (Rhodospirillum rubrum S1H)
MTAERPIPFRRAPARSSSFRALAAAFLIGGALALSACSSKKDEPEYVERPVEELYNEAVD
LLNTSSYALAAKAFDEVERQHPYSSWATKAQIMSAYALYENEAYDDAVVAINRFIELHPG
NRDIAYAYYLRGLCYYEQISDVRRDQQITRQAMSNLRDVVTRFPDSPYARDARLKIDLAR
DHIAGKEMSVGRFYLKRQDFLAALNRFRVVVEQYDQTTHVPEALYRMVEINTLLGLPDEA
KRVAAVLGHNFPGSDWYGDAYRLITGEKVPSATEGAEPPPSSSWTDSLTGWL