Protein Info for Rru_A0923 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 5 to 12 (8 residues), see Phobius details transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF25928: DUF7973" amino acids 5 to 156 (152 residues), 96.9 bits, see alignment E=5.5e-32 amino acids 170 to 295 (126 residues), 96.2 bits, see alignment E=8.6e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0923)

Predicted SEED Role

"COG0531: Amino acid transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVX1 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Rru_A0923 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MTVIGLLAAFGGGIFGAAIGALPAFEFVGFLVMIGVAVQIGVSPAETNFFGIPFGMFGPH
VGGFASGVAAAAYAASRGKLDSGRNIVAGMMGLNSPDVLLVGGAFGILGYLIQWGLAQVP
NFGAGIPWTDTVALTVVISAIIARLLFGKTGLFGKAEPGRAFYAPSDKAKWLSFQSEPLQ
LTVIGLGVGLMAGYLGATYGAPGVFLSFGIAAASLIFLQFGVLVPVSHHIALPAAIVAAS
SGSIVWAGIAGILCAFVGEFYARTFLSHGDTHIDPPACTIATMTLIFNFLTSVGFWTIAH
IPF