Protein Info for Rru_A0917 in Rhodospirillum rubrum S1H

Annotation: Methionine adenosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 4 to 101 (98 residues), 131.8 bits, E=1.8e-42
• TIGR01034: methionine adenosyltransferase
  • amino acids 6 to 379 (374 residues), 515.1 bits, E=5.5e-159
• PF02772: S-AdoMet_synt_M
  • amino acids 113 to 229 (117 residues), 136.9 bits, E=5.6e-44
• PF02773: S-AdoMet_synt_C
  • amino acids 231 to 370 (140 residues), 203.7 bits, E=1.6e-64

Best Hits

Swiss-Prot: 100% identical to METK1_RHORT: S-adenosylmethionine synthase 1 (metK1) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to rru:Rru_A0917)

MetaCyc: 55% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-methionine salvage cycle III (6/11 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.6

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See Q2RVX7 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Rru_A0917 Methionine adenosyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MRAYCVTSESVTEGHPDKVCDQISDGILDACLAQDPAARVAVETLVSGNTVFIAGEITTT
ARLDAVRTAREVIEDIGYADPALGFDSGSCFILTNLRTQSPDIDLGVSRGAELGAGDQGV
LYGYACDETASLMPAPIHMAHGLSLRLAAARHGGVLPWLRPDGKTQVTVRYDGEGRPEAL
TSVIVSTQHDEGVDRETLVRGIIEAVIYPEVGGWLKPETRVLINPTGRFVIGGPAGDTGV
TGRKLMVDTYGGCARHGGGAFSGKDSTKVDRTAAYMARYAAKNVVAAGLARRCEVALAYA
IGERLPEMVSVETFGTETIDVDRLTAAVRETFPFSVSGMIAALDLRRPIFRKTAAYGHFG
RENKGFQWEKTDRVDALRAVCGL