Protein Info for Rru_A0894 in Rhodospirillum rubrum S1H

Annotation: stress protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF02342: TerD" amino acids 1 to 187 (187 residues), 288.8 bits, see alignment E=7.3e-91

Best Hits

Swiss-Prot: 71% identical to TERE_ALCSP: Tellurium resistance protein TerE (terE) from Alcaligenes sp.

KEGG orthology group: K05795, tellurium resistance protein TerD (inferred from 100% identity to rru:Rru_A0894)

Predicted SEED Role

"Tellurium resistance protein TerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW00 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Rru_A0894 stress protein (NCBI) (Rhodospirillum rubrum S1H)
MAVSLSKGGNVSLSKEAPGLTAINVGLGWDARVTDGSAFDLDASAFLLNEAGKIRSDADF
IFYNNKTSSDGSVVHQGDNQSGAGEGDDETVAIDLTKVPADVQKVAFSVTIHEADARKQN
FGQVTNAFIRVVNQADGKEITRYDLSEDYSTETAMIFGELYRNGADWKFKAIGQGFAGGL
GPLAKNFGVNIG