Protein Info for Rru_A0890 in Rhodospirillum rubrum S1H

Annotation: Integral membrane protein TerC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 8 to 331 (324 residues), 341 bits, see alignment E=3.6e-106 PF03741: TerC" amino acids 72 to 294 (223 residues), 139.4 bits, see alignment E=5.7e-45

Best Hits

Swiss-Prot: 55% identical to TERC_SERMA: Tellurium resistance protein TerC (terC) from Serratia marcescens

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to rru:Rru_A0890)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW04 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Rru_A0890 Integral membrane protein TerC (NCBI) (Rhodospirillum rubrum S1H)
MAHFGFPIETIIIFFTVIGFSVFIDLFAHRHAKEISVRDASLWSCFWIGLALAFFAYLWL
RFDKTWADLYLAGYALEKSLSIDNLIVFMAIFASFGIKGVLQHRILYWGIIGALVFRAIF
VAVGTGLFALAPWVGFIFAAIVAWSGWKMLTSGGDNEEITDYSEHWSVKITARLMPVFPR
LYAERFFVNRAIVADLAKSDPTLKLAKNAAVFATPAFLCLMAIETSDVMFAFDSVPAVIA
VTQEPLLVYAAMIFAVLGLRSLYFVLAAMTKYLVHLEKAVIVLLFFIAAKLTLQSGEHVF
GWDFLHISPNVSLLIVLGTLAAGVIASFIWPAKEEKAE