Protein Info for Rru_A0885 in Rhodospirillum rubrum S1H

Annotation: TonB-dependent siderophore receptor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 794 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07660: STN" amino acids 65 to 116 (52 residues), 43.4 bits, see alignment 3.6e-15 PF07715: Plug" amino acids 159 to 258 (100 residues), 89.4 bits, see alignment E=3.3e-29 TIGR01783: TonB-dependent siderophore receptor" amino acids 160 to 794 (635 residues), 341.9 bits, see alignment E=4.2e-106 PF00593: TonB_dep_Rec_b-barrel" amino acids 347 to 760 (414 residues), 173.6 bits, see alignment E=2e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0885)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW09 at UniProt or InterPro

Protein Sequence (794 amino acids)

>Rru_A0885 TonB-dependent siderophore receptor (NCBI) (Rhodospirillum rubrum S1H)
MQGIIRGVLMAGTALVALPVLGGPVQAADQPAGRQGAEVSEGVAFKIAAQSLDGAVVAFG
RQSGWQVSVDPPILAGKSTPGVSGRMTPEAALAQLLSGTGVTWRRTDAKTVVLSKAEVDG
VVTLDPLRVEGRAESAYGPVGGYVAKRSATATKTDTAILDTPQSITVVGAEEMETRNVQT
LEDAIKYTPGVALSYGATGDTRSSWYQMRGFPVTTTFYRDGMKVSGQSWQKIDSYLLERV
EILRGPASVLYGQNEPGGLVNAVSKRPQDTQQGEATIEYGSFDWKRAEGDITGPLDDEGH
WLYRFSAALQDSDGLNGIDHDRNDRKVFAPSLTWTPRDETFVTLSAVYQEDDSRGWWPRQ
SYRSAAGTVDPSTYLGEPDYDSYHQEQNHLTLQAEHAVDESLKVNLSARYSKVNLTYHQT
WPGAIEEGGTTIDRGNYAYKQDASVYTVDAHVQKKLSLFSTHHTLLGGIDYLNQDRDELF
GMASDNGISLINPVYGTYNVAKADSFSKGDVRSAGLYAQDQIEIGEHWVFQLGGRQDLAG
WAGASDYESTFTGRLGVAYKTDFGLVPYASYAESFEPQSGSGWGGARFEPTTGRQYEVGV
KYEPPGTNIMATVAVFDLVKQNVLTTDPDPTHLCEGSRCSVQTGEVTSQGVEVGLTMGLA
AGLNAVAAYTYNPIEVTKSTIAGEVGRQQAATPIHTASLWADYTVQNGPLAGLGLGGGLR
FIGKTTSSADDLSTGPQIIDEAMVRYAVKDWKMSMNVKNILDRDIEYSCNNQAHGRVCYL
NEPLTITARLTRSF