Protein Info for Rru_A0864 in Rhodospirillum rubrum S1H

Annotation: ABC transporter, transmembrane region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 51 to 294 (244 residues), 71.7 bits, see alignment E=8.2e-24 PF00005: ABC_tran" amino acids 365 to 514 (150 residues), 92 bits, see alignment E=5.1e-30

Best Hits

KEGG orthology group: K06020, sulfate-transporting ATPase [EC: 3.6.3.25] (inferred from 100% identity to rru:Rru_A0864)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW30 at UniProt or InterPro

Protein Sequence (603 amino acids)

>Rru_A0864 ABC transporter, transmembrane region (NCBI) (Rhodospirillum rubrum S1H)
MTDGTSARNAIPARPILWRLLFPERHRLALALAITLLAALAELPPYALLSQSIGLALTGT
ASGGDLLGLAGWMGAALLIKFLLYSLAYYLSHVAAYRLLADIRQTLVRRLAVAPLIWLQR
HSSGDLKKIVLQDVERLEQFIAHHTVECLAALASPVFVALVLAWIDWRLAAAALLTLPLA
ATLQALLMRGLGPRIEDYGRTIGALNGATVEYIRNAPVMKAFCQNARSFEHMRDLLARYH
AMITAMTRKTVPGWSAFMVLLGANIVFLLPFGLWLHRQHALELTEVILAVMLGSGMLKPL
FKVAHFSSEIGEILAGVRRLAPLLAFQPTAPAAVAPAPAAAADSAFADAITFDRVSFSYG
ARTILQDVSFTLKAGGFTALVGPSGAGKSTIAHLMGGLVLADRGDIRVGAVSLSSLSEAG
RAGLIGVASQDSFLFAGTLMDNLRLGRPEAGADMVRHAARIAQAEDFIAALPEGYATTLG
ERGTRLSGGERQRIALARALISQTPVLVLDEATAFADGRTERRFYQALRAAYPDQTLLVI
AHRLTAIAQADQILVLEDGRVIDGGRHADLLERCPLYQTLWRRQFDSETWSIRPKGTADA
AHS