Protein Info for Rru_A0863 in Rhodospirillum rubrum S1H

Annotation: ABC transporter, transmembrane region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 80 (28 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 31 to 270 (240 residues), 72.2 bits, see alignment E=9e-24 PF00005: ABC_tran" amino acids 344 to 493 (150 residues), 113.4 bits, see alignment E=1.9e-36

Best Hits

KEGG orthology group: K06020, sulfate-transporting ATPase [EC: 3.6.3.25] (inferred from 100% identity to rru:Rru_A0863)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW31 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Rru_A0863 ABC transporter, transmembrane region (NCBI) (Rhodospirillum rubrum S1H)
MNRVIATSGRPKGALWRGLGLRVLERIFAITPFFLGSLWLADAVSGREPALSLPLLGMCL
AALLAGQMLCSYLGQMACFLGAYDLMIGYREQVIDHIGRLPLGVLQKRRIGHLAAIVTDD
VKRVEEIFTHVAIDLVAAASAPLLFLAVLTWVDWRLSLALMVTLPMAIIGLNAARGFFLA
RGRTKQTLVQETSGLIVEFVTGLKTLRLFNQTAPWLDRLDRRFAALREISLGVEAWGGGS
IQLYRLCLEGGLVSLLLTAGWLANRGALDPLAWVLFALVAGKLLEPLLDAAAFLTELRLM
VLAEGRIAALRAEPLLPEGTATLAAAGEVAFQNVSFRYDDAWVLRDVSFRVGAGTMTAIV
GPSGSGKTTLLHLLARFFDPQAGAVTIAGRDIRTLDTQDLYRHLGFVFQDVQLFDGTLLE
NLLIGRPGADEAAVAAACTAAYCDPFLARLPDGLASRIGENGQRLSGGERQRLSIARAIL
KDAPILLLDEATASVDPAAQYEIQRALSHLAQGRTVIMVAHRLHTIRHADQILVLDQGRI
LEQGRHDDLLAQAGLYAALWREQSR