Protein Info for Rru_A0860 in Rhodospirillum rubrum S1H

Annotation: RND efflux system, outer membrane lipoprotein, NodT (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 11 to 468 (458 residues), 393.2 bits, see alignment E=8.4e-122 PF02321: OEP" amino acids 66 to 257 (192 residues), 51.9 bits, see alignment E=4.3e-18 amino acids 290 to 466 (177 residues), 69.3 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0860)

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW34 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Rru_A0860 RND efflux system, outer membrane lipoprotein, NodT (NCBI) (Rhodospirillum rubrum S1H)
MNMAFLVAPSLIALILGGCAPWDGIDRQSAMTDAKTLALSAPSDPIPEVAPWPEGEWWRG
YHDAQLNQLIGEALAGNPSLKVAQARLRRAGALAGLAEAALSPHLDGGASIIDQRFNEGG
LYPDSLAGKVKTENKIALEGAYTLDLWGGREAEYRSALGELRASEIDAQAARLDLAAAIA
QSYARLAAAFDQRDISHEVLRQKQEIQALTARQVRSGLVTEVETRQADAAIAAARADIAG
DEERISLLRRDLAVLTGAGPDRGAAITRPGLSMRAGVGLPSTLPADLIGRRPDIVAHRWR
IEAATRSIDAAKARFYPNVDLTAFLGFKSIGLANFMTAGSFMAGAGPAITLPIFDAGRLR
SQLAEANATLDITVELYNGAVLEALRDIVGSLTSWRANQARLAEKSLAVASLEEAYRLAL
LRYREGLANYLTVLSAETALIAERRQEAEFRNRQYGLSIALAHALGGGFAPQGPPPSRAA
SGDPAPRAPL