Protein Info for Rru_A0845 in Rhodospirillum rubrum S1H

Annotation: TonB-dependent siderophore receptor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 PF07715: Plug" amino acids 60 to 158 (99 residues), 66 bits, see alignment E=4e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 62 to 703 (642 residues), 431.8 bits, see alignment E=2.6e-133 PF00593: TonB_dep_Rec_b-barrel" amino acids 233 to 671 (439 residues), 205.4 bits, see alignment E=3.1e-64

Best Hits

Swiss-Prot: 54% identical to FPTA_PSEAE: Fe(3+)-pyochelin receptor (fptA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to rru:Rru_A0845)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW49 at UniProt or InterPro

Protein Sequence (703 amino acids)

>Rru_A0845 TonB-dependent siderophore receptor (NCBI) (Rhodospirillum rubrum S1H)
MPSPRAMAEEEAGSEVSKSSEVTSDQSQVETLPPLLVEDTKVYGSQSLRGATLSKMPLEM
REIPQSVSVIDRQRMEQQNLTDLDDVMEKATGVTVQPYQQLTTQYYVRGFQADSFEIDGS
PVGIGYQASSPQDMAVYDRVEILRGSNGMLHGSGNPAATINLVRKKPTDTFQSSVDLSGG
SWDTYRGEADLGGPLIENGAVRGRLVGAYEKKGYFYDEAEQKTGLAYGVIEADLSDTTLL
TLGGQYQAIDAVPNIAGVPMAADGSDLGLSRSRYLNTDWSANDWRTVRAFGALEHQWGGG
WTSKLSLEYEKSSSDLKYGALYGSNIDAETGNGAILMPGAYRFHDENRSVDLHANGPFKL
LGKDHHALFGLNSNRRQHKVDTGTFETNIARPVNVYTWDPSSVPEPGVSRYDTTSDSDTR
EAGFYAMGRFSIADPLTLVLGSRFSGWQQDTLTSSYSTGLQWIPYSGLIWDFADDWSAYA
GYTSVFQPQTSLTYDGGILDPIEGRSYEVGIKGALYEDRLNVSAALFRIEQSNRAVEDPD
HPSVGRTTYYINGGKVRSQGVELEVNGKVMPDWDVSAGYTYTDTKYLEDPNNQGDEFSTT
TPHHMFKLWTNYTLPWEEKRWSVGAGLNAQSEITKTSNSITMKQSPYVTMDLRLAYRIMP
TVTASLNVKNISNEKYYQELFSPNWSNRYGEPRSVTFGVRATF