Protein Info for Rru_A0841 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, AraC family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF12833: HTH_18" amino acids 220 to 296 (77 residues), 69.1 bits, see alignment E=3.3e-23 PF00165: HTH_AraC" amino acids 264 to 296 (33 residues), 30.5 bits, see alignment 3.1e-11

Best Hits

Swiss-Prot: 71% identical to PCHR_PSEAE: Regulatory protein PchR (pchR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12243, AraC family transcriptional regulator, transcriptional activator of the genes for pyochelin and ferripyochelin receptors (inferred from 100% identity to rru:Rru_A0841)

Predicted SEED Role

"Transcriptional regulator PchR" in subsystem Siderophore pyochelin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW53 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Rru_A0841 Transcriptional Regulator, AraC family (NCBI) (Rhodospirillum rubrum S1H)
MSITIITPPKTAGIVVKPESRMDVSCIDPQMTLMAGTYCSDTEDWYEEPLERGVRLILVQ
SGRLRCRVPGQPEHLIEGPMLCTIANAGDFTSAQVYDTARPLRYTMLQLFDDDLEGRLGW
LPDSLRPRRGEDPLMISCPATKAIQALASQIATCQMDGPIRDFYLGGKALELAALSVQTL
SGAPATGSDESITSAEVERIHAARAILVEALREPPTLDQLALRVGMNRRKLTLGFRKVFG
TSVFCYLQEYRLREAHRMLCDEEANVSTVAHLVGYSPAHFATAFRKRYGLSPRDIR